DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or82a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:352 Identity:89/352 - (25%)
Similarity:161/352 - (45%) Gaps:35/352 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSA 131
            |.:::|..|..:.   |:.:|::|:...|..|:|...|.:|.|.:........|..|: .|.:.|
  Fly    57 DMEKVTACLSVVF---TNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYRE-GLDYVA 117

  Fly   132 MAARI-----NFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWF-------TPFNMTMPKV 184
            .|.::     ..:.:|.| .|...:.|.||:...:..         |.       .|..|..|..
  Fly   118 EANKLASFLGRAYCVSCG-LTGLYFMLGPIVKIGVCR---------WHGTTCDKELPMPMKFPFN 172

  Fly   185 LLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSP 249
            .|..|.:.:.:::......|.:......||.:..|..:|.|.|:.||.:||:...|.::    ..
  Fly   173 DLESPGYEVCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSE----PD 233

  Fly   250 VQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAML 314
            .|:     :::|::..|..::.|:|..|..||...:..||..::.:|..:..|:|..::.:..:|
  Fly   234 TQI-----RLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLL 293

  Fly   315 YVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVP 379
            |.::..:.:.||.:|||||.::...|..:..|:....|.|..||.|..:.|:||:||:.|.:...
  Fly   294 YASFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAG 358

  Fly   380 FFSPSLATFAAILQTSGSIIALVKSFQ 406
            ||..|||.|..|.:|:.|:|.|:||.:
  Fly   359 FFVASLANFVGICRTALSLITLIKSIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 83/337 (25%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 81/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.