DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or65c

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:457 Identity:92/457 - (20%)
Similarity:163/457 - (35%) Gaps:122/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLRFLKRDQQLD-----VYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGM 63
            |..|  ||..::     ||::   |..:..|..:........|:||..|..::       :.|.:
  Fly    18 WKHF--RDPTMESSYSAVYYW---REQMKAMFLYTTSKERQMPYRSSWHTLVI-------IQATV 70

  Fly    64 CFLDRQQITLALETLCPAGTSA----------VTLLKMFLMLRFR--------QDLSIMWNRLRG 110
            |||          |:|...|.:          :..:..|..:.|:        .:|..:...|. 
  Fly    71 CFL----------TMCYGVTESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEALE- 124

  Fly   111 LLFDPNWER--PEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVW 173
             .|.| |.:  |...|.|     .|.|   |..:..||..:::     |:.:.:::.......:|
  Fly   125 -TFHP-WAQKGPGAVDYR-----TAKR---WYFTLAFFLASSW-----LVFLCIFILLLITSPLW 174

  Fly   174 ----FTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYF------------EFCAH 222
                ..|.:...|.........|:::.|        |::|...:..||            .....
  Fly   175 VHQQILPLHAAFPFQWHEKSIHPISHAF--------IYLFQTWNVMYFLTWLVCIEGLSVSIYVE 231

  Fly   223 LSALFEVLQAEIESMFR---PYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIIT 284
            ::...|||..|:..:.:   .| :.|.|...:|....||:..::...|.:...|...:.......
  Fly   232 ITFAIEVLCLELRHLHQRCHGY-EQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFL 295

  Fly   285 LAHFVSAAM--------VIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESST 341
            ::..|..||        |..|:::.||.||:                  |.::.|.|.|:::.|.
  Fly   296 VSLSVLEAMEARKDPKVVAQFAVLMLLALGH------------------LSMWSYFGDLLSQKSL 342

  Fly   342 GLCRAMFSC--PWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAIL-QTSGSIIALV 402
            .:..|.:..  |.:..|...|.|. |:|.|.|.|:.| |.||.|.:...::||| |..|.:..|:
  Fly   343 TISEAAYEAYDPIKGSKDVYRDLC-LIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLL 406

  Fly   403 KS 404
            |:
  Fly   407 KT 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 73/376 (19%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 70/355 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.