DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or65b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:288 Identity:63/288 - (21%)
Similarity:112/288 - (38%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WPLSAGFFTCTTYNLKPILIAMIL-------YLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLT-- 194
            |.....||..|:::....::.::|       :.||        .||:...|.........|::  
  Fly   141 WYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQN--------LPFHAAFPFQWHEKSLHPISHA 197

  Fly   195 --YIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPY--TDHLELSPVQLYIL 255
              |:|.:|.....:......:|......|.::...|||..|:..:.|..  ...|.:...:|..|
  Fly   198 IIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYGLQELRMETNRLVKL 262

  Fly   256 EQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTL-----GNNGLGAMLY 315
            .||:..::.|.|.:...|...:               |.:.||:|:|..|     ..:......:
  Fly   263 HQKIVEILDRTNDVFHGTLIMQ---------------MGVNFSLVSLSVLEAVEARKDPKVVAQF 312

  Fly   316 VAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSC--PWQLFKPKQRRLVQLLILRSQRPVSM-A 377
            ....:.||..|.::.|.|..:::.|..:..|.:..  |.:..|...|.|. ::|.|.|.|:.| |
  Fly   313 AVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDLC-VIIRRGQDPLIMRA 376

  Fly   378 VPFFSPSLATFAAIL-QTSGSIIALVKS 404
            .||.|.:|..::||| |..|.:..|:|:
  Fly   377 SPFPSFNLINYSAILNQCYGILTFLLKT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 60/278 (22%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 60/277 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.