DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or65a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:159/446 - (35%) Gaps:122/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FAVPRL-SLDIMGYWPGKTGD--------------------TWPW----------RSLIHFAILA 52
            |..|:. |..|:.||   |.|                    .|.:          .||.:....:
  Fly    27 FKAPQAKSRHIIAYW---TRDQLKALGFYMNSEQRRLPRIVAWQYFVSIQLATALASLFYGISES 88

  Fly    53 IGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNW 117
            ||....|...:.|:    ||:..  :|         .::....::..:|.::.:.|..:.   :|
  Fly    89 IGDIVNLGRDLVFI----ITIIF--IC---------FRLVFFAQYAGELDVIIDALEDIY---HW 135

  Fly   118 --ERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWF----TP 176
              :.|..::::     ...|::|....|...|..::        :||::..:.....|.    .|
  Fly   136 SIKGPATKEVQ-----ETKRLHFLLFMALIITWFSF--------LILFMLIKISTPFWIESQTLP 187

  Fly   177 FNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMF----GGCD----GFYFE-------FCAHLSAL 226
            |:::.|..|.:....|:.||.|..:...|:..|    |..:    ..:||       .|..|..|
  Fly   188 FHVSWPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSALRVLCIELRNL 252

  Fly   227 FEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLT----RFFRDRYTIITLAH 287
            .|:...:.:.::|      ||..:..:            |..||.||    ..|...:.:..|.:
  Fly   253 QELCLGDEDMLYR------ELCRMTKF------------HQQIILLTDRCNHIFNGAFIMQMLIN 299

  Fly   288 FVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPW 352
            |    :::..|:..:|....|...|:.|:...:..|..|..:...|.:.::.|..:..|::    
  Fly   300 F----LLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVY---- 356

  Fly   353 QLFKPKQ-----RRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALV 402
            :.:.|..     .|.....|.|:|:|:.| |.||...:|..:..||:...||:.::
  Fly   357 EAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 65/356 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 58/299 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.