DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or2a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:409 Identity:90/409 - (22%)
Similarity:149/409 - (36%) Gaps:118/409 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLR 109
            |...::||..:.|...||:|    :.:|:.:       |..|..||...:...|:.|..:.:.||
  Fly    52 LFPLSLLARLLFTTNMAGLC----ENLTITI-------TDIVANLKFANVYMVRKQLHEIRSLLR 105

  Fly   110 ------GLLFDPNWERPEQRDIRLKHSAMAARIN-----FWPLSAGFFTCTTYNLKPILI---AM 160
                  .|:.||.           :.||:...:|     |...::.|...||.:...:::   ..
  Fly   106 LMDARARLVGDPE-----------EISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRE 159

  Fly   161 ILYLQNRYEDFVWFTP--FNMTMPKVLLN-YPFFPLTYIFI---AYTGYVTIFMFGGCDGFYFEF 219
            :||.       .||..  .:.|...||:| |..|.|....|   |...|...|:           
  Fly   160 LLYP-------AWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFL----------- 206

  Fly   220 C---AHLSAL-------------------FEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSV 262
            |   .|:.||                   :|..:.|:      |.:.:|                
  Fly   207 CLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV------YQELIE---------------- 249

  Fly   263 IIRHNAIIDLTRFFRDR------YTIITLAHFV-SAAMVIGFSMVNLLTLGNNGLGAMLY-VAYT 319
                 .|.||.|..|.|      .::..:|.|| |||:....:|..|....::...||:. :.:.
  Fly   250 -----CIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFF 309

  Fly   320 VAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRP-VSMAVPFFSP 383
            .|...::.|.||.|..:...|..||.|.:.|.|....||.:|.:...:.|:||| :..|..:.:.
  Fly   310 SAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIAL 374

  Fly   384 SLATFAAILQTSGSIIALV 402
            ||.||..:::.:.|:..|:
  Fly   375 SLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 81/376 (22%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 84/387 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.