DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or1a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:409 Identity:93/409 - (22%)
Similarity:159/409 - (38%) Gaps:64/409 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFL--DRQQITLALETLCPA 81
            |...|:.||:.   |.|.|:.  .||.:.:.|:.:..:.||.....|:  :|.||.|..|.|...
  Fly    17 FTFARMGLDLQ---PDKKGNV--LRSPLLYCIMCLTTSFELCTVCAFMVQNRNQIVLCSEALMHG 76

  Fly    82 GTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFF 146
            .....:||||.:.|....||..:..:::....:.:....|.|....:...|||  .::.:.||  
  Fly    77 LQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMAA--IYFMMCAG-- 137

  Fly   147 TCTTYNLKPILIAMILYLQN----RYEDFVWFTPFNMTMPKVLLNYPF------FPLTYIFIAYT 201
            |..::.|.|:.:.|:.|...    ....|....|:::|.|.|   |..      |.|::...:.|
  Fly   138 TSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHV---YAMDCCLMVFVLSFFCCSTT 199

  Fly   202 GYVTIFMFGGCDGFYFEFCAHLSALFEVLQ--------AEIESMFRPYTDHLELSPVQLYILEQK 258
            |..|  ::|.|            ||...||        ..|.|.|.|......||          
  Fly   200 GVDT--LYGWC------------ALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLS---------- 240

  Fly   259 MRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGF--SMVNLLTLGNNGLGAMLYVAYTVA 321
              .:.:.|..::.:.:.|  .|:.:.:| ||...::.|.  |::....:.:..........:::.
  Fly   241 --GIFVEHARLLKIVQHF--NYSFMEIA-FVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFSLV 300

  Fly   322 ALSQLLVYCYGGTLVAESSTGLCRAMFS-CPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSL 385
            ..:||.:|.:|...|...:....|.::. .|||...||.|:|....|.|:||...:...||....
  Fly   301 VTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYFFELGR 365

  Fly   386 ATFAAILQTSGSIIALVKS 404
            .....|.:|:||...|:.:
  Fly   366 PLLVWIFRTAGSFTTLMNA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 76/346 (22%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 71/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.