DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or46a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:360 Identity:70/360 - (19%)
Similarity:136/360 - (37%) Gaps:89/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LLKMFLMLRFRQDLSIM---------WNRLRGL---LFDPNW---ERPEQRDIRLKHSAMAARIN 137
            :||:|.|  |..::|.|         ..:|.||   :..|.:   ...|.:.:.|...|:....|
  Fly    66 ILKVFFM--FATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQMLELDRVAVVRMRN 128

  Fly   138 FWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDF--------------VWFTPFNM-------TM 181
                        :|.:..:..|.::.:...:::|              .|...::.       .:
  Fly   129 ------------SYGIMSLGAASLILIVPCFDNFGELPLAMLEVCSIEGWICYWSQYLFHSICLL 181

  Fly   182 PKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLE 246
            |..:||     :||..:||:                 ....|....::|...:|.: .|.     
  Fly   182 PTCVLN-----ITYDSVAYS-----------------LLCFLKVQLQMLVLRLEKL-GPV----- 218

  Fly   247 LSPVQLYILEQKMRSVIIRHNAII---DLTRFFRDRYTIITLAHFVSAAMVIGFSMVNL--LTLG 306
            :.|.....:..::|.....:|.|:   ||...|......:.|   :.:.:|:..::.::  :::.
  Fly   219 IEPQDNEKIAMELRECAAYYNRIVRFKDLVELFIKGPGSVQL---MCSVLVLVSNLYDMSTMSIA 280

  Fly   307 NNGLGAMLYVA-YTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRS 370
            |.....||... |.:..|.|:.:.||....|...|:.||.:::|..|..:....||:|.|::.|.
  Fly   281 NGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRF 345

  Fly   371 QRPVSMAV--PFFSPSLATFAAILQTSGSIIALVK 403
            ..|:.::.  |.|:.||..|.:|:..|.|..||:|
  Fly   346 NSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 65/351 (19%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 65/351 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.