DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR34

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_320910.3 Gene:GPROR34 / 1281356 VectorBaseID:AGAP002125 Length:380 Species:Anopheles gambiae


Alignment Length:417 Identity:87/417 - (20%)
Similarity:155/417 - (37%) Gaps:88/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YWPGK-----TGDTWPWRSLIHF-AILAIGVATELHA---GMCFLDRQQITLALETLCPAG---- 82
            |.||:     ....|.|:....| |.:...||..::.   ..|.:......|.|....|..    
Mosquito     2 YDPGRFIFPMRFSMWAWKVCGFFNAPVPKSVAYRVYCYAFYSCIMAVYLFVLLLNVFVPQPFEQR 66

  Fly    83 ---------TSAVTLLKMFLMLRFRQDLSIMWNRLR---GLLFDPNWERPEQRDIRLKHSAMAAR 135
                     |....:||...:.|   ..:|:|:...   |:.|.|..|  ::|:::.:..|:   
Mosquito    67 VFFIMYIFLTETAMILKTLTIYR---HFNIVWSLYETTLGVSFQPRDE--QERELQQRRLAV--- 123

  Fly   136 INFWPLS-------AGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPL 193
            .|.|..:       |.|.|.          :.:|..:.|...|.|                ||.:
Mosquito   124 FNRWYYAYIFVSHMAAFGTG----------SHLLSAEYRMPFFPW----------------FFGV 162

  Fly   194 TYIFIAYTGYVTIFMFGGCDGFYFEFC------AHLSALFEVLQAEIESMFRPYTD-----HLEL 247
            .|...|:..|.|||.:... |.||...      ..|..:..::..::|.:.:.:.|     ..:.
Mosquito   163 PYWEDAHVAYYTIFAYQSF-GMYFHMLLNTAGDTQLCYMMHMIGIQLELLGKRFRDLNNCEEFDR 226

  Fly   248 SPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGA 312
            |.|.|.....|:..::.|...:.....|.  ::::..|....||..|.  ||:||     |....
Mosquito   227 SFVPLVQHYNKIHRMLCRVQNLFSPAYFV--QFSVSGLVICASAYQVA--SMLNL-----NDFSK 282

  Fly   313 MLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMA 377
            ::.|.|.::...|:.:.||.|..|...|..|..|::|..|.......|:.||:.::|:.:|.::|
Mosquito   283 LMNVFYMMSMTMQIGLPCYYGNEVTLKSYALTNAIYSSRWYDMPQSNRKSVQMFLVRTNKPFAVA 347

  Fly   378 V-PFFSPSLATFAAILQTSGSIIALVK 403
            . .:|:.:|..|..||..:.|:..:::
Mosquito   348 AFGYFNFNLPAFTTILNMAYSVYCVLQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 76/360 (21%)
GPROR34XP_320910.3 7tm_6 71..367 CDD:251636 73/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.