DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR66

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_319538.1 Gene:GPROR66 / 1279769 VectorBaseID:AGAP003310 Length:393 Species:Anopheles gambiae


Alignment Length:273 Identity:59/273 - (21%)
Similarity:113/273 - (41%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 ILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPL----TYIFIAYTGY---------VTIF 207
            :|....|::.:.|..:::|.        |.:..|.|||    ..|:.|| ||         :.::
Mosquito   132 VLYTSSLFIFSLYPAYMYFV--------VHVKVPIFPLYIPGINIYSAY-GYGITNSFHMLIAVY 187

  Fly   208 -MFGG--CDGFYFEFCAHL---SALFEVLQAEIESMFRPYTDHLE-LSPVQLYILEQKMRSVIIR 265
             :||.  .|..:..|..|.   ..||::...:.:........|.| .:.|......|:||::...
Mosquito   188 GLFGALTSDIVFIMFVVHFVTYGGLFKIECEQFDQDLSGVFQHCEWRTAVYKTFCRQRMRAIYQY 252

  Fly   266 HNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAY--TVAALSQLLV 328
            |.::|......::.|..|.:....|.::...|::...||..       .|..|  .|.::.||.|
Mosquito   253 HQSVIFYLESMQECYRNICVVQVASCSLSTVFNLFLALTTD-------WYATYGFIVISVFQLFV 310

  Fly   329 YCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLATFAAIL 392
            ||..||::...:..:...:.:.||.:...::::..:.::.|||....:.:....| ::.||..|:
Mosquito   311 YCLMGTVMQIMNERMIDYISNLPWYMLPTEEQKQFKFMLARSQLSAEIMIRSVGPMNMETFTDIM 375

  Fly   393 QTSGSIIALVKSF 405
            |...|..|::.||
Mosquito   376 QKMYSAFAMMYSF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 55/262 (21%)
GPROR66XP_319538.1 7tm_6 62..376 CDD:251636 54/259 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.