DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR3

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317837.3 Gene:GPROR3 / 1278355 VectorBaseID:AGAP011469 Length:408 Species:Anopheles gambiae


Alignment Length:302 Identity:68/302 - (22%)
Similarity:120/302 - (39%) Gaps:75/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 HSAMAARINFWPLSAGFFTCTTY--------NLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVL 185
            |.:||....|.|:      .|||        :.:|  :..:|:|    |:.::|.....:|    
Mosquito   152 HFSMATFFWFMPV------WTTYSAYFAVRNSTEP--VEHVLHL----EEELYFLHIRTSM---- 200

  Fly   186 LNYPFF-----PLTYIFIAYTG---YVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYT 242
            .:|.|:     |..|. :.:||   .:|||.       ..::|   ||:.:::...|..      
Mosquito   201 AHYTFYVAIMWPTIYT-LGFTGGTKLLTIFS-------NVKYC---SAMLKLVALRIHC------ 248

  Fly   243 DHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAM----------VIGF 297
                |:.|:....|:::..:|..|..::|........:..:....|:...|          |.||
Mosquito   249 ----LAEVRQDRAEKELNEIISMHQRVLDCVFLLETTFRWVFFVQFIQCTMIWCSLILYIAVTGF 309

  Fly   298 SMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRL 362
            |.    |:.|..:..:|....|..       |||.||.:...|..:..|::...|..|....||.
Mosquito   310 SS----TVANVCVQIILVTVETYG-------YCYFGTDLTTESYSVALAIYDSEWYKFSISMRRK 363

  Fly   363 VQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVK 403
            ::||:.|||:|:.: |..|...::|.|..:|:.|.|...::|
Mosquito   364 LRLLLQRSQKPLGVTAGKFRFVNVAQFGKMLKMSYSFYVVLK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 65/293 (22%)
GPROR3XP_317837.3 7tm_6 93..398 CDD:251636 65/293 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.