DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR5

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317840.2 Gene:GPROR5 / 1278352 VectorBaseID:AGAP011467 Length:391 Species:Anopheles gambiae


Alignment Length:360 Identity:80/360 - (22%)
Similarity:139/360 - (38%) Gaps:82/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 MLRFRQDLSIMWNRLRGLL--------FDPNWER-------------PEQRD---IRLKH----- 129
            |:|...:|...||.|.|:|        :|....|             |.|..   :|:.|     
Mosquito    61 MVRGTAELIFEWNVLFGMLLFSLKLDDYDDLVYRYKDISKIAFRKDVPSQMGDYLVRINHRIDRF 125

  Fly   130 ------SAMAARINFW--PLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWF-TPFNMTMPKVL 185
                  |.:...|.:|  |.|:.:........:.:.:..:|:|:   |:..|| |..:      |
Mosquito   126 SKIYCCSHLCLAIFYWVAPSSSTYLAYLGARNRSVPVEHVLHLE---EELYWFHTRVS------L 181

  Fly   186 LNYPFFPLTYIFIAYTGYVTIFM---FGGCDGF-YFEFCAHLSALFEVLQAEIESMFRPYTDHLE 246
            ::|..|  |.|.:.     ||||   |||.... .|....:.||:..::...|:.|.|  .|..|
Mosquito   182 VDYSIF--TAIMLP-----TIFMLAYFGGLKLLTIFSNVKYCSAMLRLVAMRIQFMDR--LDERE 237

  Fly   247 LSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAM-----VIGFSMVNLLTLG 306
                    .|:::..:|:.|...:.........:..:.|..|:...|     |:..::..|.|..
Mosquito   238 --------AEKELIEIIVMHQKALKCVELLEIIFRWVFLGQFIQCVMIWCSLVLYVAVTGLSTKA 294

  Fly   307 NNGLGAMLYVAYTVAALSQLLVYCY-GGTLVAE-SSTGLCRAMFSCPWQLFKPKQRRLVQLLILR 369
            .| :| :|::..||....    :|| |..|.:| ....|.||.:...|.......:|.:::::.|
Mosquito   295 AN-VG-VLFILLTVETYG----FCYFGSDLTSEVRCYSLTRAAYGSLWYRRSVSIQRKLRMVLQR 353

  Fly   370 SQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVK 403
            :|:||.: |..|....:..|..:.:||.|...::|
Mosquito   354 AQKPVGISAGKFCFVDIEQFGNMAKTSYSFYIVLK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 77/351 (22%)
GPROR5XP_317840.2 7tm_6 57..381 CDD:251636 77/351 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.