DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR22

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_317343.1 Gene:GPROR22 / 1277839 VectorBaseID:AGAP008114 Length:388 Species:Anopheles gambiae


Alignment Length:389 Identity:85/389 - (21%)
Similarity:153/389 - (39%) Gaps:97/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ILAIGVATELHAGMCFL-DRQQITLALETLCPAGTSAVTL-LKMFLMLRFRQDLSIMWNRLRGLL 112
            ::::||.. ||| .|:. |...|.|::.    |..||..| ||:..|:..|:.::.|   ||.:|
Mosquito    56 VVSLGVIL-LHA-YCYRNDLDTIILSVS----AFVSAFELMLKINGMVYRRKQIAAM---LRTVL 111

  Fly   113 FD-PNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTP 176
            .| .:...|.:..|..|:..:|.::                   :|:.::.||            
Mosquito   112 SDRSSLNGPIEAVICGKYQRLARKL-------------------LLVTILSYL------------ 145

  Fly   177 FNMTMPKVLLNYPF---------FPLTYIFIAYTGYVT------------------IFMFGGCDG 214
               |...:||.||.         .||.| .|.:..|.|                  ..:|.|.||
Mosquito   146 ---TTGAMLLIYPVVSGGLADRTLPLGY-SIPFADYRTHPWYLINYLLQIVQVQWVALVFVGLDG 206

  Fly   215 FYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDR 279
            .::.|..:.::..|:|..        |...:..||..:....:.||.|...|..:..........
Mosquito   207 PFYLFVCYSASQLEILIV--------YLRQIGESPDNVQEQRRLMRKVFEIHTGLSQFVARCSSI 263

  Fly   280 YTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLV----AESS 340
            |..:.|...:.:.:.|..|:.::.....||...||     :..::::.::||.|.||    ||.|
Mosquito   264 YREVYLMQVLCSIVHICVSLFHIQIKFKNGSYGML-----LTNVNKIWLFCYCGELVVSKAAEFS 323

  Fly   341 TGLCRAMFSCPW-QLFKPKQRRLVQLLILRSQRPVSMAVPFFS-PSLATFAAILQTSGSIIALV 402
            ||    :::..| :|:..:..:.:..::..:||....::..|. .|.|||.|:::|:.|..|.:
Mosquito   324 TG----VYANQWYRLWNRRDLQDILFMLRNAQRNYGFSIGGFGFLSFATFTAVMKTAYSCNAFL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 76/360 (21%)
GPROR22XP_317343.1 7tm_6 72..377 CDD:251636 77/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.