DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR6

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_316227.4 Gene:GPROR6 / 1276835 VectorBaseID:AGAP006167 Length:405 Species:Anopheles gambiae


Alignment Length:425 Identity:94/425 - (22%)
Similarity:146/425 - (34%) Gaps:139/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FAILAIGVATELHAGMCFLDRQQITLALETLCPA-GTSAVTLLKMFLMLRFRQDLSIMWNRLRGL 111
            |.:||.....||.......:|....|.:....|. |...:.:|||.::.|.|..::    .|.| 
Mosquito    47 FLLLAYTTIGELIYLKQMFERDVTFLEVTFQAPCIGYCTIGVLKMVILARGRNTIA----ELVG- 106

  Fly   112 LFDPNWE----------------RPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAM 160
            ||...|.                ||            |.|:......|.......:.:.|  ||.
Mosquito   107 LFRAKWTSAIVTGAHWAVCEDTMRP------------AIRVTSVTALANVVMGIAFTILP--IAE 157

  Fly   161 ILYLQ------NRYEDF-VWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFE 218
            ::|..      ||...| :|: ||:: :..|...:..:|| |:.|.:|| :.|.|...|      
Mosquito   158 MIYTHHYTGRWNRQLAFNIWW-PFDV-LGGVKYYWFVYPL-YVVIGFTG-IIIHMAFDC------ 212

  Fly   219 FCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHN--AIIDL--------- 272
                   ||.:|.|.:...||                       |:.||  .::::         
Mosquito   213 -------LFCILAAHLCMQFR-----------------------ILAHNFGHVVEVANGAREGDS 247

  Fly   273 --TRFFRDRYTIITLAHFVSAAMVIGFSMVNL---LTLGNNGLGAMLYVAYTVAALSQLLVYCYG 332
              |...||...|    |    ..:||:....|   :....||...:.:|.:.:..|.:||:.|..
Mosquito   248 GSTSRLRDAIRI----H----QELIGYEGTPLDAGVNQWRNGYMLVKFVLFMLCFLIELLMLCAY 304

  Fly   333 GTLVAES----------------------STGLCRAMFSCPWQ-----LFKPKQRRLVQLLILRS 370
            |..:.||                      |.|:..|.:.|.|.     .|    .|.|..:|.||
Mosquito   305 GEDIVESVRHQAVMSESRVIEAFAFKTHQSLGVIDAAYGCEWYREGSVAF----HRSVLQIIHRS 365

  Fly   371 QRPVSM-AVPFFSPSLATFAAILQTSGSIIALVKS 404
            |:.|.: |...:...::||:.|||.|.|...|:|:
Mosquito   366 QQSVILTAWKIWPIQMSTFSQILQASWSYFTLLKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 84/393 (21%)
GPROR6XP_316227.4 7tm_6 84..391 CDD:251636 81/377 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.