DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR32

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_315048.1 Gene:GPROR32 / 1275762 VectorBaseID:AGAP004951 Length:384 Species:Anopheles gambiae


Alignment Length:357 Identity:80/357 - (22%)
Similarity:141/357 - (39%) Gaps:89/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCT- 149
            |.|||..|.:.:|   |.|:|.:...          :|.::....|..||         |..|: 
Mosquito    73 VMLLKFNLFITYR---SGMYNLVEAF----------KRILKCIDKAEFAR---------FVKCSE 115

  Fly   150 ------------------TYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPF------ 190
                              .|.|..|:.::.|.||.....||  |||         ::||      
Mosquito   116 LHAKLLRAYVIGTSIVLLLYELNAIVASITLSLQQNKVCFV--TPF---------SFPFDYQHPI 169

  Fly   191 -FPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYI 254
             |.||::.......||:......|..:.|..::|:..|::::...|.        |:||..|.| 
Mosquito   170 VFALTFLHNFDAMLVTVCTSVTVDSCFSEMASNLTIHFDIVRERFEK--------LDLSAAQPY- 225

  Fly   255 LEQKMRSVIIRHNAIIDLTR-----FFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAML 314
            .|.::|:||..|..::.|.:     :.:..:.::.|...:...:...|.||           :.:
Mosquito   226 AEHQLRNVITYHREVLSLAQKMVQLYQQSAFYLLLLVSTILCLLGYEFVMV-----------SNI 279

  Fly   315 YVAYTVAALSQLL-----VYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPV 374
            |....||.|:.::     :|.|.|:.::..|..:..|::...|.......::||.:.::|:|:||
Mosquito   280 YKRMQVAILASIMIGQAAIYTYHGSAISAKSVSVADAIYGTNWYDAPLAVKKLVYICLMRAQKPV 344

  Fly   375 SMAVPFFSPSLATFAAILQTSGSIIALVKSFQ 406
            .|...|...||.|...||.:|.|.|.::.|.:
Mosquito   345 IMKSGFIEASLPTLKKILSSSASYITMLMSLE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 76/345 (22%)
GPROR32XP_315048.1 7tm_6 71..365 CDD:251636 76/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.