DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and OR7_ANOGA

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_312379.3 Gene:OR7_ANOGA / 1273405 VectorBaseID:AGAP002560 Length:478 Species:Anopheles gambiae


Alignment Length:152 Identity:37/152 - (24%)
Similarity:75/152 - (49%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EQKMRSVI----IRHNAIIDLTRFFRDRYTIITLAHFVSAAM---VIGFSMVNLLTLGNNGLGAM 313
            |..:||.|    .||..::.|.....|.|....|.|.:::.:   ::.:....:..:...||..:
Mosquito   323 EMMVRSAIKYWVERHKHVVRLVSAIGDTYGPALLLHMLTSTIKLTLLAYQATKIDGVNVYGLTVI 387

  Fly   314 LYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMA- 377
            .|:.|   ||:|:.::|..|..:.|.|:.:..|.:||.|.....:.:..||::..:.|:.:::: 
Mosquito   388 GYLCY---ALAQVFLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMTISG 449

  Fly   378 VPFFSPSLATFAAILQTSGSII 399
            ..||:.||..||::|   |:::
Mosquito   450 AKFFTVSLDLFASVL---GAVV 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 36/147 (24%)
OR7_ANOGAXP_312379.3 7tm_6 68..464 CDD:251636 35/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.