DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and GPROR14

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_310085.1 Gene:GPROR14 / 1271313 VectorBaseID:AGAP009408 Length:409 Species:Anopheles gambiae


Alignment Length:283 Identity:57/283 - (20%)
Similarity:118/283 - (41%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YNLKPILIAMILYLQNRYEDF--------VW-------FTPFNMTMPKVLLNYPFFPLTY--IFI 198
            |.:.|::.:..:|.|:.::..        :|       ...|::.|.:     .|:.|.:  ..:
Mosquito   141 YLVAPVITSFGVYFQSVWQSHHDTNDTIRIWEISQVAPHRQFSLHMEQ-----DFYGLQHRTNIL 200

  Fly   199 AYTGYVTIFMFGGCDGFYFEFC-AHLSAL---FEVLQAEI---ESMFRPYTDHLELSPVQLYILE 256
            .||.|:.:.:    ...:...| .|:..|   ..|..||:   ..|.:  .|:|...|.|..|.|
Mosquito   201 HYTLYIAVIV----PMMFVTACTVHMKVLTIASSVRYAEMLLHVVMLK--VDNLHRIPNQKSIRE 259

  Fly   257 QKMRSVIIRH----NAIIDLTRFFRDRYTI-ITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYV 316
            : :..:|..|    |.|..|.:..|....: :....|:...|::.|::.:..::....| |:|:|
Mosquito   260 E-LHDIIHVHQRTLNCITLLVQALRPILMVQLVFCVFIWCLMMLFFTIADKFSVAFFNL-AILFV 322

  Fly   317 AYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPF 380
            ..|:...|.    ||.||.::..:..|.::::.|.|.......::.:::::.|:|.||.: |..|
Mosquito   323 VITIETFSA----CYFGTRLSTQAVELSKSVYGCGWPAMDRDIQQGLRMVLHRTQSPVGIQAGKF 383

  Fly   381 FSPSLATFAAILQTSGSIIALVK 403
            ....:..|..::..|.|...::|
Mosquito   384 CFVDVELFQNMVNKSYSFFIVLK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 54/274 (20%)
GPROR14XP_310085.1 7tm_6 <258..399 CDD:251636 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.