DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and GUK1

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_010742.1 Gene:GUK1 / 852065 SGDID:S000002862 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:35/169 - (20%)
Similarity:69/169 - (40%) Gaps:27/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YGHMLSSTSMVRTP---DVESGYFEKSESDASRDEWEGPSSSSSGAARCRLLSGISGLSVSSSSR 212
            :|..:|||:  |||   :|..    |..:..|.||::....::......:......|.:|:|..:
Yeast    30 FGFSVSSTT--RTPRAGEVNG----KDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQ 88

  Fly   213 HSAEGLRMELSRFRTMIETLERESLE--KSQSELQLKAKSKAKPKPKQRSHVQDAAGESGSEQGS 275
            .|..|        :|.|..::.:.::  |:..||..:....|.|..:......:..|....|..:
Yeast    89 VSKSG--------KTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESIN 145

  Fly   276 ERGFWSTIFGQAGLAISQ-DEEERIA---DIQKAHRALE 310
            :|    ....||.||.:: ...:::.   |:.||::.|:
Yeast   146 KR----LSAAQAELAYAETGAHDKVIVNDDLDKAYKELK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187 3/8 (38%)
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492
SH3_DLG-like 862..922 CDD:212795
GUK1NP_010742.1 guanyl_kin 3..185 CDD:213788 35/169 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.