DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and GK-1

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_001323630.1 Gene:GK-1 / 818788 AraportID:AT2G41880 Length:416 Species:Arabidopsis thaliana


Alignment Length:330 Identity:59/330 - (17%)
Similarity:110/330 - (33%) Gaps:123/330 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 TPMVNSQSTEPGSRYAS----TNVLAAVPPGTPRAVS------TEDITREPR------TITIQKG 750
            :|:|.....:|...|::    ...:..:..|:||..|      .....||.:      .:...||
plant    67 SPIVLGTGPKPSKGYSAFVLEQGRILVIKKGSPRNDSIWFLEVDSPYVREQKKLLRKEVVAWSKG 131

  Fly   751 PQGLGFN--IVGGED--GQGIYVSFILAGGPADLG-----------------------------S 782
            .:|....  ::.|..  |:|..:|.::...|:..|                             .
plant   132 VRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEK 196

  Fly   783 ELKRGD--QLLSVNNVNLTHATHEEAAQALKTSG-------GVVTLLAQYRPEEYNRFEARIQEL 838
            |:|.|.  :..||:. || :.|..|:.:|:..||       |::|       :.:..|:....|.
plant   197 EIKDGKFLEFASVHG-NL-YGTSIESVEAVTDSGKVYKKAFGLIT-------DAFCVFDLLNNEF 252

  Fly   839 ----KQQAALGAGGSGTLLRTTQKRSLYVRALFDYDPNR---DDGLPSRGLPFKHGDILHVTNAS 896
                .|:..|.....|.  |:.:..||....:|...|:.   :|.|.:|                
plant   253 CFCPTQRCILDIDVQGA--RSVRASSLDAIFIFVCPPSMKELEDRLRAR---------------- 299

  Fly   897 DDEWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDRSVKFQGHAAA-------NNNLDKQSTLD 954
                       |...:|||         ::::|..:..:| :|.::.       |:||::   ..
plant   300 -----------GTETEEQI---------QKRLRNAEAEIK-EGISSGIFGLILYNDNLEE---CY 340

  Fly   955 RKKKN 959
            :|.||
plant   341 KKLKN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 23/125 (18%)
SH3_DLG-like 862..922 CDD:212795 9/62 (15%)
GK-1NP_001323630.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.