DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and SYNJ2BP

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_060843.2 Gene:SYNJ2BP / 55333 HGNCID:18955 Length:145 Species:Homo sapiens


Alignment Length:131 Identity:50/131 - (38%)
Similarity:69/131 - (52%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 VNGDDSWLY--EDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDII 506
            :||...:|.  |:|.|.||.|||||:|.||||..::..|:.||::::...||||.||||...|.|
Human     1 MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKI 65

  Fly   507 VSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTATTPAAGSAAGDARDSAASGPKVIEIDL 571
            :|||...:.::.|..|||..:.||..|.|.|:.:......|......||        |..|.|.:
Human    66 LSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGD--------PSGIPIFM 122

  Fly   572 V 572
            |
Human   123 V 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570 39/85 (46%)
PDZ_signaling 566..655 CDD:238492 3/7 (43%)
PDZ_signaling 742..820 CDD:238492
SH3_DLG-like 862..922 CDD:212795
SYNJ2BPNP_060843.2 PDZ_signaling 13..97 CDD:238492 38/83 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.