DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and PALS2

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_001289966.1 Gene:PALS2 / 51678 HGNCID:18167 Length:540 Species:Homo sapiens


Alignment Length:428 Identity:101/428 - (23%)
Similarity:155/428 - (36%) Gaps:135/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 IPGDNG------IYVTKLMDG----GAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELA-VATL 644
            :|...|      |::..:|:.    ..|:...||. ..||.||    |:.|||.|...|. :..|
Human    11 LPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLE-DSKLEAV----SDNNLELVNEILEDITPL 70

  Fly   645 KSITDKVTLIIG--KTQHLTTSASGGGGGGLSSGQQLSQSQSQLATSQSQSQVHQQQHATPMVNS 707
            .::.:.|..::|  |..|.               |.|.::...:|     |:.:....::|.:|:
Human    71 INVDENVAELVGILKEPHF---------------QSLLEAHDIVA-----SKCYDSPPSSPEMNN 115

  Fly   708 QSTEPGSRYASTNVLAAVPPGTPRAVSTEDITREPRTITIQK---GPQGLGFNIVGGEDGQGIYV 769
            .|.        .|.|..|.     |:         |.:.|.|   .|.|:.|.:    :...:.:
Human   116 SSI--------NNQLLPVD-----AI---------RILGIHKRAGEPLGVTFRV----ENNDLVI 154

  Fly   770 SFILAGGPADLGSELKRGDQLLSVNNVNLTHATHE------EAAQALKTSGGVVTL--LAQYRPE 826
            :.||.||..|....|..||.:..||.       ||      |..:.||...|.|||  |..||. 
Human   155 ARILHGGMIDRQGLLHVGDIIKEVNG-------HEVGNNPKELQELLKNISGSVTLKILPSYRD- 211

  Fly   827 EYNRFEARIQELKQQAALGAGGSGTLLRTTQKRSLYVRALFDYDPNRDDGLPSR--GLPFKHGDI 889
                                        |...:.::|:..|||:|..|:.:|.:  ||.|..|:|
Human   212 ----------------------------TITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEI 248

  Fly   890 LHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERK----MRARDRSVKFQGHAAANNNLDKQ 950
            |.:.|..|..||||..|   .|....|::||:...|::    .|..|.|..|.|           
Human   249 LQIVNREDPNWWQASHV---KEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCG----------- 299

  Fly   951 STLDRKKKN---FTFSRKFPFMKSRDEKNEDGSDQEPF 985
             |:..|||.   :..:|...|.:...:..|:.:...||
Human   300 -TISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492 19/74 (26%)
PDZ_signaling 742..820 CDD:238492 25/88 (28%)
SH3_DLG-like 862..922 CDD:212795 24/61 (39%)
PALS2NP_001289966.1 L27 2..55 CDD:197794 12/48 (25%)
L27 57..108 CDD:397114 13/70 (19%)
PDZ_signaling 133..206 CDD:238492 24/83 (29%)
SH3_MPP6 219..279 CDD:212971 24/62 (39%)
Guanylate_kin 337..527 CDD:395500 101/428 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.