DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and Mpp2

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_001343253.1 Gene:Mpp2 / 50997 MGIID:1858257 Length:569 Species:Mus musculus


Alignment Length:323 Identity:78/323 - (24%)
Similarity:120/323 - (37%) Gaps:103/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 KLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKTQHLTTSASGGGGGGLSSGQQLSQSQ 683
            ||.|||.|    |||.|...|                                     :.|::..
Mouse    76 KLEAVRDN----NLELVQEIL-------------------------------------RDLAELA 99

  Fly   684 SQLATSQSQSQVHQQQHATPMVNSQSTEPGSRYASTNVLAAVPPGTPRAVSTEDITREP------ 742
            .|.:|:...:::.|:.|...::.:..:.....|.:       ||.:|....|  .:.:|      
Mouse   100 EQSSTAAELARILQEPHFQSLLETHDSVASKTYET-------PPPSPGLDPT--FSNQPVPPDAV 155

  Fly   743 RTITIQK--GPQ-GLGFNIVGGEDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHE 804
            |.:.|:|  |.. |:.|.:.|||    :.::.||.||.......|..||.:..||...:  .:..
Mouse   156 RMVGIRKTAGEHLGVTFRVEGGE----LVIARILHGGMVAQQGLLHVGDIIKEVNGQPV--GSDP 214

  Fly   805 EAAQAL--KTSGGVV-TLLAQYRPEEYNRFEARIQELKQQAALGAGGSGTLLRTTQKRSLYVRAL 866
            .|.|.|  ..||.|: .:|..|                |:..|             .|.::|:..
Mouse   215 RALQELLRSASGSVILKILPSY----------------QEPHL-------------PRQVFVKCH 250

  Fly   867 FDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERK 927
            |||||.||...|.:  ||.|..||:|.:.|..|..||||..|.|.:    .|::||:...|::
Mouse   251 FDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGS----AGLIPSQLLEEKR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492 11/35 (31%)
PDZ_signaling 742..820 CDD:238492 25/89 (28%)
SH3_DLG-like 862..922 CDD:212795 26/61 (43%)
Mpp2NP_001343253.1 L27 30..83 CDD:197794 5/6 (83%)
L27 85..136 CDD:308467 10/94 (11%)
PDZ_signaling 155..233 CDD:238492 24/83 (29%)
SH3_MPP2 246..304 CDD:212970 26/61 (43%)
GuKc 376..557 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.