DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and MPP3

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_001317162.1 Gene:MPP3 / 4356 HGNCID:7221 Length:610 Species:Homo sapiens


Alignment Length:288 Identity:78/288 - (27%)
Similarity:125/288 - (43%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 QSQSQLATSQSQSQVHQQQHATPMVNS---------QSTEPGSRYA---------STNVLAAV-- 725
            :|.|.|.....:.:.:::|..||:::|         :..:..|.::         ||..|.||  
Human    66 KSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLM 130

  Fly   726 --------------PPGTPRAVSTEDITREP-RTITIQKGPQGLGFNIVGGEDGQGIYVSFILAG 775
                          || .|..:. ||...|. :.:.:.|..:.||..|...|....:.|:.|:.|
Human   131 VHDTVAQKNFDPVLPP-LPDNID-EDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRG 193

  Fly   776 GPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQ 840
            |.||....:..||:|..||.:.:.|...:|.:|.|..|.|.:||......:|    |.|::|.| 
Human   194 GAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQE----EDRLKESK- 253

  Fly   841 QAALGAGGSGTLLRTTQKRSLYVRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQA 903
                                :::||||.|:|..|..:|.:  ||||:...:|.|.:..|..||||
Human   254 --------------------VFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQA 298

  Fly   904 RRVLGDNEDEQIGIVPSKRRWERKMRAR 931
            :|| ||. :.:.|::|||...||::..|
Human   299 KRV-GDT-NLRAGLIPSKGFQERRLSYR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 23/78 (29%)
SH3_DLG-like 862..922 CDD:212795 26/61 (43%)
MPP3NP_001317162.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.