DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and guk1b

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_957018.1 Gene:guk1b / 393697 ZFINID:ZDB-GENE-020916-1 Length:223 Species:Danio rerio


Alignment Length:264 Identity:57/264 - (21%)
Similarity:97/264 - (36%) Gaps:73/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GPS----SSSSGAARCRLL-------SGISGLSVSSSSRHSAEG---------LRMELSRFRTMI 229
            ||.    |..|||.:..||       .|:.|.|||.::|:...|         |.|.|.  .|::
Zfish     3 GPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKGLNCLPMLLG--ATLL 65

  Fly   230 ETLERESLEKSQSELQLKAKSKAKPKPKQRSHVQDAAGESGSEQGSERGFWSTIFGQAGLAISQD 294
            ...:..|...|: :.....|.|.:....:...:::|.            |...::|.:       
Zfish    66 PVADVLSSVTSE-DYHFVTKEKMQEGIDKDEFIENAE------------FSGNMYGTS------- 110

  Fly   295 EEERIADIQKAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQ----EFYEL 355
             :..|.|:| |...:.:|:               :.|:.|..|.|:.|....:.||    |..|.
Zfish   111 -KSSIEDVQ-AQNLICILD---------------VDIQGVRNIKKTDLNPIYISIQPPSMEILEK 158

  Fly   356 TLLD---DSKSIQQKTAETLQIATKWEKDG---QAVKIADNQRMRIESDTENAKEPTVEQQQKQQ 414
            .|.|   :::...||..|..:|..:..|:.   ..|.:.|:    :|...|..|...:|:.:|.|
Zfish   159 RLRDRQTETEDSLQKRLEAARIDMELSKEPGVFDIVIVNDD----LEEAYEKLKSVLIEEIEKVQ 219

  Fly   415 QAQQ 418
            .||:
Zfish   220 DAQK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187 13/59 (22%)
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492
SH3_DLG-like 862..922 CDD:212795
guk1bNP_957018.1 Gmk 1..219 CDD:223272 54/258 (21%)
guanyl_kin 5..213 CDD:213788 50/250 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.