DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and vari

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster


Alignment Length:403 Identity:110/403 - (27%)
Similarity:171/403 - (42%) Gaps:82/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 SQSQLATSQSQSQVHQQQHATPMVNSQSTEPGSRY--------ASTNVL-AAVPPGTPRAVSTED 737
            |.|:...|:..:::..|.|...::.:.. |.|:.|        .||:.| .|....|...:.|||
  Fly    99 SPSRRLESRELAKLLAQPHFRALLRAHD-EIGALYEQRLKAAGGSTSQLEIASQRQTGGYLFTED 162

  Fly   738 I--TREP----RTITIQKGP-QGLGFNIVGGEDGQGIYVSFILAGGPADLGSELKRGDQLLSVNN 795
            :  |:.|    :.:.:::.| :.||..:...|..| :.|:.|||||..|..|.|..||.:|.||.
  Fly   163 VLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ-LVVARILAGGVIDKQSMLHVGDVILEVNG 226

  Fly   796 VNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQAALGAGG----SG-TLLRT 855
            ..:  .|.:|....:..:...:||......:|         |:|......:||    :| ..|.|
  Fly   227 TPV--RTPDELQVEVSRAKENLTLKIGPNVDE---------EIKSGRYTVSGGQVKQNGIASLET 280

  Fly   856 TQKRSLYVRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIV 918
            .:|.:.|:||||.|:|:.|..||.|  |||||.||||.:.|..|..||||:.:..  |.::||::
  Fly   281 GKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITA--ESDKIGLI 343

  Fly   919 PSKRRWERK------------------MRARDRSVKFQGHAAANNNLDKQSTLDRKKKNFTFSRK 965
            ||:...||:                  .|...|..|....:.||...||...|..::    .:|.
  Fly   344 PSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEE----VTRM 404

  Fly   966 FPFMKS------------RDEKNE-DGSDQEPF--MLCYTQDDANA--EGGEIIYRVELPDMEQI 1013
            .||.:.            |..||. ..||.:.|  ::.:|.....|  |.|...:.::..:||:.
  Fly   405 PPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEA 469

  Fly  1014 T-----LIYLENN 1021
            .     |.|.|:|
  Fly   470 VRNNEFLEYGEHN 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 23/82 (28%)
SH3_DLG-like 862..922 CDD:212795 31/61 (51%)
variNP_724288.3 L27 <105..128 CDD:280918 3/23 (13%)
PDZ_signaling 173..250 CDD:238492 23/79 (29%)
SH3_MPP 287..347 CDD:212796 31/61 (51%)
Guanylate_kin 408..622 CDD:279019 16/75 (21%)
GuKc 418..622 CDD:214504 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.