DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and mpp7a

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:XP_021335692.1 Gene:mpp7a / 30166 ZFINID:ZDB-GENE-991209-8 Length:621 Species:Danio rerio


Alignment Length:263 Identity:66/263 - (25%)
Similarity:111/263 - (42%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 SSGQQLSQSQSQLATSQSQSQVHQ------QQHATPMVNSQSTEPGSRYASTNVLAAVPPGTPRA 732
            |:|...:....:|....:.:::.:      :.|...:::...|.....|.        |...|..
Zfish    71 SAGSLAADLTEELQARSASNEIRELVKLLSKPHVKSLLSVHDTVAKKSYD--------PELPPLP 127

  Fly   733 VSTEDITREPRTITIQKGPQGLGFNIVGGEDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVN 797
            ...:|.....:.|.:.|..:.||..|...|....|.|:.||.||.||....:..||:|..||.:.
Zfish   128 DDIDDEEDSVKIIRLVKNKEPLGATIKKDEHTGAILVARILRGGAADRSGLIHVGDELKEVNGIP 192

  Fly   798 LTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQAALGAGGSGTLLRTTQKRSLY 862
            :.....||..:.|..|.|.:|...             :..:|.:|            .:::..::
Zfish   193 VDDKKPEEIIRILSQSQGAITFKV-------------VPGIKDEA------------QSKEPKMF 232

  Fly   863 VRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWE 925
            ::|||||:|..|..:|.:  ||.||.||||.|.:..|..|||| ::.||. :.:.|::|||...|
Zfish   233 IKALFDYNPAEDKAIPCKEAGLGFKKGDILQVMSQDDATWWQA-KLEGDG-NLRAGLIPSKHFQE 295

  Fly   926 RKM 928
            |::
Zfish   296 RRL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 25/77 (32%)
SH3_DLG-like 862..922 CDD:212795 27/61 (44%)
mpp7aXP_021335692.1 L27 12..68 CDD:197794
L27 74..125 CDD:197794 5/58 (9%)
PDZ_signaling 137..217 CDD:238492 25/92 (27%)
SH3 232..292 CDD:327375 27/61 (44%)
GuKc 403..608 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.