DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and magu-3

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_491260.2 Gene:magu-3 / 183676 WormBaseID:WBGene00016841 Length:479 Species:Caenorhabditis elegans


Alignment Length:328 Identity:74/328 - (22%)
Similarity:121/328 - (36%) Gaps:69/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 LSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKTQHLTTSASGGGGGGLSSGQQ 678
            :|..|:|..:|:|.  :||....|.| :..:::|..|    .||.|...::.|.|.......|::
 Worm     1 MSEEDELSQLRSNA--ENLSRCLHVL-LEKIENIEKK----NGKEQDADSTKSNGTSSSNKDGKE 58

  Fly   679 LSQSQSQLATSQSQSQVHQQQHATPMVN-SQSTEPGSRYASTNVLAAVPPGTPRAVSTEDITREP 742
            ..:          |.::.::....|... .:.|....|..:|....|:....|....| .|.|..
 Worm    59 KFE----------QVEIEEKTEIDPKTGLKKRTIVTERVLTTKTFHALALDGPSPTMT-PILRSS 112

  Fly   743 RTITIQKGPQGLGFNIVGGEDGQGIYVSFIL------------AGGPADLGSELKRGDQLLSVNN 795
            .|......|               |:.|.||            ||....:..| |.|.||: |..
 Worm   113 GTKNHNYAP---------------IHQSAILLPQYQSRKTTVDAGQLTQVEVE-KHGGQLV-VTK 160

  Fly   796 VNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQAALGAGGSGTLLRTTQKRS 860
            :|      |::...|| .|.|:|.:.  ..:.|  |.|.|:.||.:..|....:|.......   
 Worm   161 IN------EKSNYDLK-PGDVITQVD--GKDVY--FRADIENLKGKVELTVEPAGIHCAPAN--- 211

  Fly   861 LYVRALFDYDPNRDDGLPSRGLPFK--HGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRR 923
             :.|....|..:.|...|...|..:  .||::.:. :.|::|.|.|: |||.  .|:|.:|:...
 Worm   212 -FHRVQDTYSSHIDVDRPCLWLDLEVNPGDVIQIL-SKDEKWMQVRK-LGDL--TQVGYLPTSLT 271

  Fly   924 WER 926
            .|:
 Worm   272 MEK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492 11/40 (28%)
PDZ_signaling 742..820 CDD:238492 21/89 (24%)
SH3_DLG-like 862..922 CDD:212795 17/61 (28%)
magu-3NP_491260.2 PDZ 147..204 CDD:381812 20/69 (29%)
SH3 218..268 CDD:388381 15/53 (28%)
Guanylate_kin 282..464 CDD:366206
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.