DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and Mpp3

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_031889.2 Gene:Mpp3 / 13384 MGIID:1328354 Length:585 Species:Mus musculus


Alignment Length:288 Identity:77/288 - (26%)
Similarity:124/288 - (43%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 QSQSQLATSQSQSQVHQQQHATPMVNS---------QSTEPGSRYA---------STNVLAAV-- 725
            :|.|.|.....:.:.:::|..||:::|         :..:..|.::         ||..|.||  
Mouse    41 KSLSYLMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLM 105

  Fly   726 --------------PPGTPRAVSTEDITREP-RTITIQKGPQGLGFNIVGGEDGQGIYVSFILAG 775
                          || .|..:. ||...|. :.:.:.|..:.||..|...|....:.|:.|:.|
Mouse   106 VHDTVAQKNFDPVLPP-LPDNID-EDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRG 168

  Fly   776 GPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQ 840
            |.||....:..||:|..||.:.:.|...:|.:|.|..|.|.:||......:|.:||         
Mouse   169 GAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRF--------- 224

  Fly   841 QAALGAGGSGTLLRTTQKRSLYVRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQA 903
                            :...:::||||.|||..|..:|.:  ||||:...:|.|.:..|..||||
Mouse   225 ----------------KDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQA 273

  Fly   904 RRVLGDNEDEQIGIVPSKRRWERKMRAR 931
            :|| ||. :.:.|::|||:..||::..|
Mouse   274 KRV-GDT-NLRAGLIPSKQFQERRLSYR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 23/78 (29%)
SH3_DLG-like 862..922 CDD:212795 27/61 (44%)
Mpp3NP_031889.2 L27 12..64 CDD:197794 5/22 (23%)
L27 71..121 CDD:197794 6/49 (12%)
PDZ_signaling 135..215 CDD:238492 24/79 (30%)
SH3_MPP3 230..291 CDD:212972 28/62 (45%)
GuKc 395..570 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.