DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dlg1 and Mpp3

DIOPT Version :9

Sequence 1:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster
Sequence 2:NP_446120.1 Gene:Mpp3 / 114202 RGDID:620015 Length:585 Species:Rattus norvegicus


Alignment Length:289 Identity:81/289 - (28%)
Similarity:126/289 - (43%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 LSSGQQLSQ---SQSQLATSQSQSQVHQQQHATP------MVNSQSTEPGSRYASTNVLAAVPPG 728
            |.|...|::   .:.|.|:..|..:...|..:||      ||:       ...|..|....:|| 
  Rat    65 LHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVH-------DTVAQKNFDPVLPP- 121

  Fly   729 TPRAVSTEDITREP-RTITIQKGPQGLGFNIVGGEDGQGIYVSFILAGGPADLGSELKRGDQLLS 792
            .|..:. ||...|. :.:.:.|..:.||..|...|....:.|:.|:.||.||....:..||:|..
  Rat   122 LPDNID-EDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELRE 185

  Fly   793 VNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQAALGAGGSGTLLRTTQ 857
            ||.:.:.|...:|.:|.|..|.|.:||......:|.:||                         :
  Rat   186 VNGITVLHKRPDEISQILAQSQGSITLKIIPATQEEDRF-------------------------K 225

  Fly   858 KRSLYVRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPS 920
            :..:::||||.|||..|..:|.:  ||||:...:|.|.:..|..||||:|| ||. :.:.|::||
  Rat   226 ESKVFMRALFHYDPREDRAIPCQEAGLPFQQRQVLEVVSQDDPTWWQAKRV-GDT-NLRAGLIPS 288

  Fly   921 KRRWERKMRARDRSVKFQGHAAANNNLDK 949
            |:..||::..|    :..|...:..||.|
  Rat   289 KQFQERRLSYR----RTTGTIPSPQNLRK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 23/78 (29%)
SH3_DLG-like 862..922 CDD:212795 27/61 (44%)
Mpp3NP_446120.1 L27 12..64 CDD:197794
L27 71..121 CDD:197794 11/56 (20%)
PDZ_signaling 135..215 CDD:238492 24/79 (30%)
SH3_MPP3 230..291 CDD:212972 28/62 (45%)
GuKc 395..571 CDD:214504
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.