DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and Timm8a1

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_445822.1 Gene:Timm8a1 / 84383 RGDID:621801 Length:97 Species:Rattus norvegicus


Alignment Length:72 Identity:34/72 - (47%)
Similarity:44/72 - (61%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLL 71
            |:..|.:||.|:.:|.||.:....:|:..|:|||||:.||..|||...|.|..|||:||||||..
  Rat    12 LAAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQF 76

  Fly    72 ITQRFAQ 78
            |..|..|
  Rat    77 ILNRLEQ 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 28/59 (47%)
Timm8a1NP_445822.1 zf-Tim10_DDP 21..81 CDD:397210 28/59 (47%)
Twin CX3C motif 43..66 12/22 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.