powered by:
Protein Alignment Tim8 and Timm8a1
DIOPT Version :9
Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_445822.1 |
Gene: | Timm8a1 / 84383 |
RGDID: | 621801 |
Length: | 97 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 34/72 - (47%) |
Similarity: | 44/72 - (61%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLL 71
|:..|.:||.|:.:|.||.:....:|:..|:|||||:.||..|||...|.|..|||:||||||..
Rat 12 LAAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQF 76
Fly 72 ITQRFAQ 78
|..|..|
Rat 77 ILNRLEQ 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG52653 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593287at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001713 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101956 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1262 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.830 |
|
Return to query results.
Submit another query.