DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIM8

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_199894.1 Gene:TIM8 / 835153 AraportID:AT5G50810 Length:77 Species:Arabidopsis thaliana


Alignment Length:68 Identity:26/68 - (38%)
Similarity:44/68 - (64%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCI-GKPSTKLDHATETCLSNCVDRFIDTSLLIT 73
            |:.||.:||..||::|.||..:.:...:||:||| ..|.:|...:..:||::|..|::|.|::|.
plant     7 NNPELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIM 71

  Fly    74 QRF 76
            :||
plant    72 KRF 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 21/60 (35%)
TIM8NP_199894.1 zf-Tim10_DDP 13..74 CDD:397210 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3924
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2523
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto4006
orthoMCL 1 0.900 - - OOG6_101956
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.