DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIM9

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_190240.1 Gene:TIM9 / 823809 AraportID:AT3G46560 Length:93 Species:Arabidopsis thaliana


Alignment Length:85 Identity:20/85 - (23%)
Similarity:40/85 - (47%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFN---EICWEKCIGKPSTK-LDHATETCLSNC 61
            |:..:.|...||.....::   .:.|:...:..:|   |.|:..|:...:.| |....|||:..|
plant     6 MAGLDGLPEEDKAKMASMI---DQLQLRDSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRC 67

  Fly    62 VDRFIDTSLLITQRFAQMLQ 81
            .::|:..::.:..|||::.|
plant    68 AEKFLKHTMRVGMRFAELNQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 12/63 (19%)
TIM9NP_190240.1 zf-Tim10_DDP 23..82 CDD:397210 12/61 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.