DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and Timm8a2

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001102899.1 Gene:Timm8a2 / 680794 RGDID:1588172 Length:97 Species:Rattus norvegicus


Alignment Length:78 Identity:38/78 - (48%)
Similarity:47/78 - (60%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDFENLSGN----DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCV 62
            |.:.:|.|:    |.:||.|:..|.||.:|...||...|:|||||:.||..|||...|.||.|||
  Rat     3 SSWSSLGGSLGSADPQLQRFMEAEVQKQRVQLLIHHMTELCWEKCMDKPGPKLDSRAELCLVNCV 67

  Fly    63 DRFIDTSLLITQR 75
            :||||||..|..|
  Rat    68 ERFIDTSQFILNR 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 32/60 (53%)
Timm8a2NP_001102899.1 zf-Tim10_DDP 21..81 CDD:397210 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.