DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and timm8b

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001017099.1 Gene:timm8b / 549853 XenbaseID:XB-GENE-1010040 Length:94 Species:Xenopus tropicalis


Alignment Length:91 Identity:47/91 - (51%)
Similarity:63/91 - (69%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDFE---NLSGND------KELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATET 56
            ||||:   :|||..      .|||..:.:|:||||..||:|.|.::||:||:.:|..|||..||.
 Frog     1 MSDFDSNLDLSGTGASPAEAAELQRMIAVEQQKAQFTAQVHNFMDVCWDKCMDRPGNKLDSRTEN 65

  Fly    57 CLSNCVDRFIDTSLLITQRFAQMLQK 82
            ||.:||||||||:|.:|.||||::||
 Frog    66 CLVSCVDRFIDTTLSVTNRFAQIVQK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 31/59 (53%)
timm8bNP_001017099.1 zf-Tim10_DDP 25..87 CDD:367270 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8088
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8262
Inparanoid 1 1.050 99 1.000 Inparanoid score I4876
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto102953
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.