DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and timm8a

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001003637.1 Gene:timm8a / 445243 ZFINID:ZDB-GENE-040801-158 Length:90 Species:Danio rerio


Alignment Length:74 Identity:37/74 - (50%)
Similarity:47/74 - (63%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQR 75
            |.:||:|:.||.||.:....:|:..|:|||||:.||..|||..||.|..|||:||||||..|..|
Zfish     9 DPQLQQFIEIESQKQRFQQLVHQMTEVCWEKCMDKPGPKLDSRTEVCFVNCVERFIDTSQFILNR 73

  Fly    76 FAQMLQKRG 84
            ..|..:.||
Zfish    74 LEQTQRSRG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 30/59 (51%)
timm8aNP_001003637.1 zf-Tim10_DDP 14..74 CDD:281019 30/59 (51%)
Twin CX3C motif 36..59 13/22 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.