powered by:
Protein Alignment Tim8 and Tim13
DIOPT Version :9
Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648505.1 |
Gene: | Tim13 / 39327 |
FlyBaseID: | FBgn0036204 |
Length: | 92 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 40/65 - (61%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 IEKQKAQVNAQ--IHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQRFAQMLQK 82
:::|.|..||| :.:..|.|::|||.||...||...:.|:|.|:|||:|...|:::.:...||:
Fly 15 VKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYGNRLQR 79
Fly 83 82
Fly 80 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR19338 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.