DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and ddp-1

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_497467.1 Gene:ddp-1 / 175331 WormBaseID:WBGene00000941 Length:83 Species:Caenorhabditis elegans


Alignment Length:81 Identity:28/81 - (34%)
Similarity:41/81 - (50%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DKELQEF---LLIEKQKAQVNAQIHEFNEICWEKCIG--KPSTKLDHATETCLSNCVDRFIDTSL 70
            |.:|..|   |..|.|:.:...|:|.....||:.|..  :|.:|:|..|:||:.|||:|.||.|.
 Worm     5 DPQLNRFLQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCIQNCVNRMIDASN 69

  Fly    71 LITQRFAQMLQKRGGG 86
            .:.:.    |.|..||
 Worm    70 FMVEH----LSKMNGG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 22/64 (34%)
ddp-1NP_497467.1 zf-Tim10_DDP 13..75 CDD:281019 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I7866
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4079
Isobase 1 0.950 - 0.928771 Normalized mean entropy S910
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto20328
orthoMCL 1 0.900 - - OOG6_101956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.720

Return to query results.
Submit another query.