DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and Tim8

DIOPT Version :10

Sequence 1:NP_572713.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_314568.3 Gene:Tim8 / 1275330 VectorBaseID:AGAMI1_003252 Length:90 Species:Anopheles gambiae


Alignment Length:75 Identity:52/75 - (69%)
Similarity:65/75 - (86%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQR 75
            |.|||:||:.|.::|:::|||||||:|||:||:.|||.|||..|||||:|||:||:|||||||||
Mosquito    15 DPELQDFLMAENERARLSAQIHEFNDICWDKCVEKPSNKLDSRTETCLANCVNRFVDTSLLITQR 79

  Fly    76 FAQMLQKRGG 85
            |||.|||..|
Mosquito    80 FAQSLQKSQG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_572713.1 zf-Tim10_DDP 16..78 CDD:460764 42/61 (69%)
Tim8XP_314568.3 zf-Tim10_DDP 20..82 CDD:460764 42/61 (69%)

Return to query results.
Submit another query.