DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and csk

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001071067.1 Gene:csk / 556454 ZFINID:ZDB-GENE-061103-493 Length:450 Species:Danio rerio


Alignment Length:267 Identity:93/267 - (34%)
Similarity:145/267 - (54%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 IGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVSTDFHREIGIMRTLSHPNIVKF--KYWAE 960
            ||:|.:|.|..|       |...::||:|.:.....:..|..|..:|..|.|.|:|:.  ....|
Zfish   201 IGKGEFGDVMVG-------DYRGKKVAVKCIKHDATAQAFVAEASVMTQLRHNNLVQLLGVIVEE 258

  Fly   961 K-SHCIIMEYLQSGSFDIYLRFTAPN-LNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNILVD 1023
            | |..|:.||:..||...|||..... :...||::|::|:...|:||.....:||||||||:|| 
Zfish   259 KGSLYIVTEYMAKGSLVDYLRSRGRTVIGGDRLINFSMDVCKAMEYLEANNFVHRDLAARNVLV- 322

  Fly  1024 HNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMF 1088
              .:.:..|:|||||.:.|:|     .:....:|::|.||||:...:||:.|||||||:.|:|::
Zfish   323 --SEDNIAKVSDFGLTKEASS-----TQDTAKLPVKWTSPEALREKKFSTKSDVWSYGILLWEIY 380

  Fly  1089 SRGEEP-NLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSF----ATIV 1148
            |.|..| ..:|:    ::.:.|::.|.:::.|..||..:||:|:.||......||||    ..:.
Zfish   381 SFGRVPYPRIPL----KEVVPRVEKGYKMDSPDGCPPVVYDIMKQCWTLDAVVRPSFRDLREKLQ 441

  Fly  1149 DIITREV 1155
            ||||.|:
Zfish   442 DIITNEL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633
PTKc_Jak_rpt2 886..1155 CDD:270634 92/265 (35%)
TyrKc 894..1151 CDD:197581 89/261 (34%)
cskNP_001071067.1 SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190
PTKc_Csk 188..443 CDD:133213 88/260 (34%)
STYKc 195..440 CDD:214568 88/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.