DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Src64B

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:484 Identity:134/484 - (27%)
Similarity:205/484 - (42%) Gaps:123/484 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   736 ESDSPW-------------IPVKYYRNLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSTLRQEQ- 786
            :::|.|             ||:.:....::..::.    |.|...:     |.:.|...|.:|. 
  Fly   127 DTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSED----WFFENVL-----RKEADKLLLAEENP 182

  Fly   787 ----LLR--QKNLDGNILKMLDQDICPAPIFETIMDGWSDDETKRFSHHDI-------------- 831
                |:|  :.|.:|..|.:.|               |.|.......|:.|              
  Fly   183 RGTFLVRPSEHNPNGYSLSVKD---------------WEDGRGYHVKHYRIKPLDNGGYYIATNQ 232

  Fly   832 -----------FSRLNTI-KAEILPNYMPPPEIATNGTGDETVIDRSDIPFLPFPRSNMLMVIPL 884
                       :|:.|.: ...||....|.|:......|.| :.|:.:||               
  Fly   233 TFPSLQALVMAYSKENALGLCHILSRPCPKPQPQMWDLGPE-LRDKYEIP--------------- 281

  Fly   885 TSECRVIYNMENMIGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVST-DFHREIGIMRTLS 948
            .||.:::    ..:|||::|.|:.|... |..|     ||:|.|....:|| .|.:|..||:...
  Fly   282 RSEIQLL----RKLGRGNFGEVFYGKWR-NSID-----VAVKTLREGTMSTAAFLQEAAIMKKFR 336

  Fly   949 HPNIVKFKYWA----EKSHCIIMEYLQSGSFDIYLR-FTAPNLNNPRLVSFALDIANGMKYLSDM 1008
            |..:|..  :|    |:...|:.||:..||...:|| .....|:...|:..|..:|:||:||...
  Fly   337 HNRLVAL--YAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESK 399

  Fly  1009 GLIHRDLAARNILVDHNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSS 1073
            .||||||||||:|:   |:.:..||.|||||:....|.|...:..| .|::|.:||||...:||.
  Fly   400 QLIHRDLAARNVLI---GENNVAKICDFGLARVIADDEYCPKQGSR-FPVKWTAPEAIIYGKFSI 460

  Fly  1074 YSDVWSYGVTLFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPAS--CPDFIYDLMQLCWHA 1136
            .|||||||:.|.|:|:.|:.|  .|...|:| .:..::.|.|:.:|.:  .||.||.|:..||.|
  Fly   461 KSDVWSYGILLMELFTYGQVP--YPGMHSRE-VIENIERGFRMPKPTNHYFPDNIYQLLLQCWDA 522

  Fly  1137 TPRSRP----------SFATIVDIITREV 1155
            .|..||          ||:...::..|||
  Fly   523 VPEKRPTFEFLNHYFESFSVTSEVPYREV 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 21/144 (15%)
PTKc_Jak_rpt2 886..1155 CDD:270634 101/286 (35%)
TyrKc 894..1151 CDD:197581 98/274 (36%)
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 4/22 (18%)
SH2_Src_family 158..259 CDD:199827 20/124 (16%)
STYKc 285..537 CDD:214568 96/270 (36%)
PTKc_Src_like 289..538 CDD:270630 96/263 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.