DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and lyn

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001004543.1 Gene:lyn / 447804 ZFINID:ZDB-GENE-040912-7 Length:510 Species:Danio rerio


Alignment Length:263 Identity:92/263 - (34%)
Similarity:138/263 - (52%) Gaps:19/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   894 MENMIGRGHYGTVYKGHLEFNDKDQPREQVAIKML--NTMQVSTDFHREIGIMRTLSHPNIVKFK 956
            |...:|.|.:|.|:......:.|      ||:|.|  .||.|.. |..|..:|:||.|..:|:..
Zfish   247 MVKKLGAGQFGEVWMAFYNNSTK------VAVKTLKPGTMSVEA-FLEEANLMKTLQHDRLVRLY 304

  Fly   957 YWAEKSH--CIIMEYLQSGSFDIYLRFTA-PNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAAR 1018
            ....|:.  .||.||:.:||...:|:..| ..:..|:|:.|:..||.||.|:.....|||||.|.
Zfish   305 AVVTKTEPIYIITEYMANGSLLDFLKSQAGSKIQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAA 369

  Fly  1019 NILVDHNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVT 1083
            |:||   .:....||:|||||:....| .|.|:.....||:|.:||||:...|:..||:||:||.
Zfish   370 NVLV---SEMLLCKIADFGLARVIEDD-QYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVL 430

  Fly  1084 LFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATIV 1148
            |:|:.:.|:.|  .| ..|..:.::.:|.|.|:.||.:||..:|::|..||...|..||:|..|.
Zfish   431 LYEIITYGKIP--YP-GMSNSEVMSSVQRGYRMPRPENCPVELYEIMTTCWKNKPEDRPTFDYIQ 492

  Fly  1149 DII 1151
            .::
Zfish   493 SVL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633
PTKc_Jak_rpt2 886..1155 CDD:270634 92/263 (35%)
TyrKc 894..1151 CDD:197581 92/261 (35%)
lynNP_001004543.1 SH3_Lyn 65..120 CDD:212937
SH2_Src_Lyn 123..223 CDD:198227
PTKc_Lyn 237..508 CDD:270657 92/263 (35%)
Pkinase_Tyr 245..495 CDD:285015 92/261 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.