DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Csk

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster


Alignment Length:259 Identity:94/259 - (36%)
Similarity:140/259 - (54%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   894 MENMIGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVSTDFHREIGIMRTLSHPNIVKF--K 956
            :...||:|.:|.|..|.|.       .|:||:|||........|..|..:|.||.|.|:|||  .
  Fly   802 LRESIGKGEFGDVMLGILR-------NEKVAVKMLKDEGAVQKFLAEASVMTTLEHDNLVKFIGL 859

  Fly   957 YWAEKSHCIIMEYLQSGSFDIYLRFTA-PNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNI 1020
            .:..|...::.||:..||...|||... .::.....:.||.|.|:||:||....::||||||||:
  Fly   860 VFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNV 924

  Fly  1021 LVDHNGDGDCV-KISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTL 1084
            |:..    ||| |:||||||:   .:.|.....|  :||:|.:|||:...|||:.||:||:|:.|
  Fly   925 LISE----DCVAKVSDFGLAR---EECYNLDVGK--LPIKWTAPEALKNGRFSNKSDMWSFGILL 980

  Fly  1085 FEMFSRGEEP-NLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATI 1147
            :|::|.|..| ..:|:    .|.:..::.|.::..|..||..||::|:..|...|..||:||.:
  Fly   981 WEIYSFGRVPYPRIPL----ADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633
PTKc_Jak_rpt2 886..1155 CDD:270634 94/259 (36%)
TyrKc 894..1151 CDD:197581 94/259 (36%)
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 94/259 (36%)
STYKc 800..1044 CDD:214568 94/259 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.