DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and LCK

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:XP_024302814.1 Gene:LCK / 3932 HGNCID:6524 Length:567 Species:Homo sapiens


Alignment Length:622 Identity:159/622 - (25%)
Similarity:255/622 - (40%) Gaps:160/622 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 MRGDWIQQSPVKDVSVTMKMLKSDGNFMEFFRLAQTWSLIQSPQFLKLYGLTLADPYTMVMEYSR 661
            ::||..||. :||        |:.|:....|.|:.|:       ||.  ||....|:.:...:. 
Human    61 LQGDPRQQG-LKD--------KACGSLAVGFHLSPTY-------FLP--GLAFLVPHPVTPGFL- 106

  Fly   662 YGPLNKFLHSMPNVTLHCLLDLMH----------GLVRG--MHYLEDNKIIHNYIRCSNLYVTK- 713
              |:......||.|....|:..:|          |..:|  :..||.:   ..:.:..:|...: 
Human   107 --PIPARFSLMPLVFTDNLVIALHSYEPSHDGDLGFEKGEQLRILEQS---GEWWKAQSLTTGQE 166

  Fly   714 -YDPNSYVLDAKISDPGYPRPYRESDSPWIPVKYYRNLQAAKTDQFAQLWAFATTIYEIFSRCKE 777
             :.|.::|..|...:|          .||    :::||.                        ::
Human   167 GFIPFNFVAKANSLEP----------EPW----FFKNLS------------------------RK 193

  Fly   778 DLSTLRQEQLLRQKNLDGNILKMLDQDICPAPIFETIMDGWSDDETKRFSHHDI----------- 831
            |    .:.|||...|..|:.|  :.:....|..|...:..:..::.:...|:.|           
Human   194 D----AERQLLAPGNTHGSFL--IRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYIS 252

  Fly   832 ----FSRLNTIKAEILPNYMPPPEIATNGT-GDETVIDR---SDIPFLPF-------PRSNMLMV 881
                |..|:    |::.:|       ||.: |..|.:.|   :..|..|:       ||..:.:|
Human   253 PRITFPGLH----ELVRHY-------TNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLV 306

  Fly   882 IPLTSECRVIYNMENMIGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVSTD-FHREIGIMR 945
                          ..:|.|.:|.|:.|:...:.|      ||:|.|....:|.| |..|..:|:
Human   307 --------------ERLGAGQFGEVWMGYYNGHTK------VAVKSLKQGSMSPDAFLAEANLMK 351

  Fly   946 TLSHPNIVK-FKYWAEKSHCIIMEYLQSGSFDIYLRFTAPN---LNNPRLVSFALDIANGMKYLS 1006
            .|.|..:|: :....::...||.||:::||...:|:  .|:   |...:|:..|..||.||.::.
Human   352 QLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLK--TPSGIKLTINKLLDMAAQIAEGMAFIE 414

  Fly  1007 DMGLIHRDLAARNILVDHNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRF 1071
            :...|||||.|.||||   .|....||:|||||:.. .|..|.|:.....||:|.:||||:...|
Human   415 ERNYIHRDLRAANILV---SDTLSCKIADFGLARLI-EDNEYTAREGAKFPIKWTAPEAINYGTF 475

  Fly  1072 SSYSDVWSYGVTLFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHA 1136
            :..|||||:|:.|.|:.:.|..|  .|..|:.| .:..|:.|.|:.||.:||:.:|.||:|||..
Human   476 TIKSDVWSFGILLTEIVTHGRIP--YPGMTNPE-VIQNLERGYRMVRPDNCPEELYQLMRLCWKE 537

  Fly  1137 TPRSRPSFATIVDIITREVATKVTHPTDGHQSPPNQP 1173
            .|..||:|..:     |.|.......|:|...|  ||
Human   538 RPEDRPTFDYL-----RSVLEDFFTATEGQYQP--QP 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 47/267 (18%)
PTKc_Jak_rpt2 886..1155 CDD:270634 93/273 (34%)
TyrKc 894..1151 CDD:197581 92/261 (35%)
LCKXP_024302814.1 SH3_Lck 123..176 CDD:212938 9/55 (16%)
SH2_Src_Lck 181..281 CDD:198225 24/154 (16%)
PTKc_Lck_Blk 295..558 CDD:270652 97/296 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.