DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Ptk6

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001102438.1 Gene:Ptk6 / 366275 RGDID:1309098 Length:451 Species:Rattus norvegicus


Alignment Length:258 Identity:95/258 - (36%)
Similarity:135/258 - (52%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 IGRGHYGTVYKGHLEFNDKDQPREQVAIKML---NTMQVSTDFHREIGIMRTLSHPNIVKFKYWA 959
            :|.|::|.|::|..      :...:||:|::   |.:...| |..||..|:.|.|.:|:.....|
  Rat   197 LGSGYFGEVFEGLW------KGLVRVAVKVISRDNLLHQHT-FQAEIQAMKKLRHKHILSLYAVA 254

  Fly   960 EKSH--CIIMEYLQSGSFDIYLRFT-APNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNIL 1021
            ....  .||.|.:..||....||.: ..:|....||.||..:|.||.||.....|||||||||:|
  Rat   255 TAGDPVYIITELMPKGSLLQLLRDSDEKDLPILELVDFASQVAEGMCYLESQNYIHRDLAARNVL 319

  Fly  1022 VDHNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFE 1086
            |..|   :..|:.|||||:....|  .|.....::|.:|.:|||:|...:|..|||||:||.|.|
  Rat   320 VTEN---NLCKVGDFGLARLVKED--IYLSRDHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHE 379

  Fly  1087 MFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATIVD 1149
            :||||:.|  .|..::.|.|| |:.:|.|:..|..||..|:.||..||...|:.||.|..:.:
  Rat   380 IFSRGQMP--YPGMSNHETFL-RVDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633
PTKc_Jak_rpt2 886..1155 CDD:270634 95/258 (37%)
TyrKc 894..1151 CDD:197581 95/258 (37%)
Ptk6NP_001102438.1 SH3_Brk 12..69 CDD:212781
SH2_PTK6_Brk 75..174 CDD:198221
PKc_like 184..444 CDD:304357 95/258 (37%)
STYKc 192..441 CDD:214568 95/258 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.