DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and FRK

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_002022.1 Gene:FRK / 2444 HGNCID:3955 Length:505 Species:Homo sapiens


Alignment Length:448 Identity:126/448 - (28%)
Similarity:203/448 - (45%) Gaps:104/448 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   741 WIPVKYY---RNLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSTLRQEQLLRQKNLDGNILKMLD 802
            :||..|.   |:||       |:.|.|...       .:.|    .::|||..:|..|:.| :.:
Human    99 YIPSNYVAEDRSLQ-------AEPWFFGAI-------GRSD----AEKQLLYSENKTGSFL-IRE 144

  Fly   803 QDICPAPIFETIMDG---------WSDDETKRFSHHDIFSRLNTIKAEILPNY------------ 846
            .:........:::||         ..|:.....:...|||.||    |.:.:|            
Human   145 SESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLN----EFVSHYTKTSDGLCVKLG 205

  Fly   847 -------MPPPEIATNGTGDETVIDRSDIPFLPFPRSNMLMVIPLTSECRVIYNMENMIGRGHYG 904
                   :|.|...:..|.|:..|||:.|..|                        ..:|.|.:|
Human   206 KPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLL------------------------KRLGSGQFG 246

  Fly   905 TVYKGHLEFNDKDQPREQVAIKMLNTMQVS-TDFHREIGIMRTLSHPNIVKFKYWA----EKSHC 964
            .|::|  .:|:    ...||:|.|....:. .||.||..||:.|.||.:::.  :|    |....
Human   247 EVWEG--LWNN----TTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQL--YAVCTLEDPIY 303

  Fly   965 IIMEYLQSGSFDIYLR-FTAPNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNILVDHNGDG 1028
            ||.|.::.||...||: .|...::..:.|..|..:|:||.||.....|||||||||:||   |:.
Human   304 IITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNVLV---GEH 365

  Fly  1029 DCVKISDFGLAQF--ANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMFSRG 1091
            :..|::|||||:.  .:::..|.::.:..:|::|.:||||.:.:||..|||||:|:.|:|:.:.|
Human   366 NIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFGILLYEIITYG 430

  Fly  1092 EEP--NLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATI 1147
            :.|  .:...|..|     .|....||.:|::||...|::|..||:|.|:.||:|.|:
Human   431 KMPYSGMTGAQVIQ-----MLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 22/106 (21%)
PTKc_Jak_rpt2 886..1155 CDD:270634 91/272 (33%)
TyrKc 894..1151 CDD:197581 91/264 (34%)
FRKNP_002022.1 SH3_Src_like 47..104 CDD:212779 2/4 (50%)
SH2_Src_Frk 112..207 CDD:199831 21/117 (18%)
PTKc_Frk_like 225..494 CDD:270653 97/299 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.