DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Yes1

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001192061.1 Gene:Yes1 / 22612 MGIID:99147 Length:541 Species:Mus musculus


Alignment Length:376 Identity:113/376 - (30%)
Similarity:168/376 - (44%) Gaps:59/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 TLRQEQLLRQKNLDGNILKMLDQD---ICPAPIFETIMDGWSDDETKRFSHH--DIFSRLNTIKA 840
            ::|....:|..|:....::.||..   |.....|:|:     ....|.::.|  .:..:|.|:..
Mouse   195 SIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTL-----QKLVKHYTEHADGLCHKLTTVCP 254

  Fly   841 EILPNYMPPPEIATNGTGDETVIDRSDIPFLPFPRSNMLMVIPLTSECRVIYNMENMIGRGHYGT 905
            .:.|.        |.|...    |..:||                   |....:|..:|:|.:|.
Mouse   255 TVKPQ--------TQGLAK----DAWEIP-------------------RESLRLEVKLGQGCFGE 288

  Fly   906 VYKGHLEFNDKDQPREQVAIKML--NTMQVSTDFHREIGIMRTLSHPNIVK-FKYWAEKSHCIIM 967
            |:.|......|      ||||.|  .||.... |.:|..||:.|.|..:|. :...:|:...|:.
Mouse   289 VWMGTWNGTTK------VAIKTLKPGTMMPEA-FLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVT 346

  Fly   968 EYLQSGS-FDIYLRFTAPNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNILVDHNGDGDCV 1031
            |::..|| .|.........|..|:||..|..||:||.|:..|..|||||.|.||||   |:....
Mouse   347 EFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILV---GENLIC 408

  Fly  1032 KISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMFSRGEEPNL 1096
            ||:|||||:.. .|..|.|:.....||:|.:|||....||:..|||||:|:...|:.::|..|  
Mouse   409 KIADFGLARLI-EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVP-- 470

  Fly  1097 VPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATI 1147
            .|...::| .|.:::.|.|:..|..||:.:::||.|||...|..||:|..|
Mouse   471 YPGMVNRE-VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 10/59 (17%)
PTKc_Jak_rpt2 886..1155 CDD:270634 95/266 (36%)
TyrKc 894..1151 CDD:197581 94/258 (36%)
Yes1NP_001192061.1 SH3_Yes 92..149 CDD:212940
SH2_Src_family 152..251 CDD:199827 11/60 (18%)
PTKc_Yes 262..540 CDD:270654 99/296 (33%)
Pkinase_Tyr 275..524 CDD:285015 94/260 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.