DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Tec

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001106931.1 Gene:Tec / 21682 MGIID:98662 Length:630 Species:Mus musculus


Alignment Length:498 Identity:136/498 - (27%)
Similarity:215/498 - (43%) Gaps:93/498 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 LVRGMHY--LEDNKIIHNYIRCSNLYVTK-YDPNSYVLDAKISDPGYPRPYRESDSPWIPVKYYR 748
            |.||..|  ||.|.:  ::.|..:.|.:: |.|::||...|.:                      
Mouse   199 LERGQEYIILEKNDL--HWWRARDKYGSEGYIPSNYVTGKKSN---------------------- 239

  Fly   749 NLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSTLRQEQLLRQKNLDGNILKMLDQDICPAPIFET 813
            ||     ||           ||.:.|   :.:..:.|||||.::.:|..  |:.....|.....:
Mouse   240 NL-----DQ-----------YEWYCR---NTNRSKAEQLLRTEDKEGGF--MVRDSSQPGLYTVS 283

  Fly   814 IMDGWSDDETKRFSHHDIFSRLNTIKAEILPN---YMPPPEIAT----NGTGDETVIDRSDIPFL 871
            :...:..:.:..|.|:.|.....:.|...|..   :...|||..    |..|   ::.|     |
Mouse   284 LYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAG---LVTR-----L 340

  Fly   872 PFPRSNMLMVIPLT----------SECRVIYNMENMIGRGHYGTVYKGHLEFNDKDQPREQVAIK 926
            .:|.|......|.|          :...:.:..|  :|.|.:|.|..|      |.:.:.:||||
Mouse   341 RYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRE--LGSGLFGVVRLG------KWRAQYKVAIK 397

  Fly   927 MLNT-MQVSTDFHREIGIMRTLSHPNIVKFKYWA---EKSHCIIMEYLQSGSFDIYLRFTAPNLN 987
            .:.. .....||..|..:|..|:||.:|:. |..   :|...|:.|:::.|....:||....:.:
Mouse   398 AIREGAMCEEDFIEEAKVMMKLTHPKLVQL-YGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFS 461

  Fly   988 NPRLVSFALDIANGMKYLSDMGLIHRDLAARNILVDHNGDGDCVKISDFGLAQFANSDGYYYAKS 1052
            ...|:|...|:..||:||.....|||||||||.||:..|   .||:||||:|::. .|..|.:.|
Mouse   462 RDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAG---VVKVSDFGMARYV-LDDQYTSSS 522

  Fly  1053 KRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLN 1117
            ....|::|..||..:..||||.|||||:||.::|:|:.|..|.   .:.:..:.:..:..|.||:
Mouse   523 GAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEGRMPF---EKNTNYEVVTMVTRGHRLH 584

  Fly  1118 RPASCPDFIYDLMQLCWHATPRSRPSFATIVDIITREVATKVT 1160
            ||.....::|::|..||...|..||||..::..|...|..:.|
Mouse   585 RPKLASKYLYEVMLRCWQERPEGRPSFEDLLRTIDELVECEET 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 32/151 (21%)
PTKc_Jak_rpt2 886..1155 CDD:270634 89/272 (33%)
TyrKc 894..1151 CDD:197581 88/260 (34%)
TecNP_001106931.1 PH_Btk 7..148 CDD:269944
SH3_Tec 182..236 CDD:212838 13/38 (34%)
SH2_Tec_Itk 239..346 CDD:198259 28/157 (18%)
PTKc_Tec_Rlk 364..623 CDD:270685 89/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.