DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Matk

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:XP_006513357.1 Gene:Matk / 17179 MGIID:99259 Length:506 Species:Mus musculus


Alignment Length:291 Identity:105/291 - (36%)
Similarity:155/291 - (53%) Gaps:37/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 IGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVSTDFHREIGIMRTLSHPNIVKF------- 955
            ||.|.:|.|.:|       :...::||:|.:.....:..|..|..:|..|.|.|:|:.       
Mouse   240 IGEGEFGAVLQG-------EYLGQKVAVKNIKCDVTAQAFLDETAVMTKLQHRNLVRLLGVILHH 297

  Fly   956 -KYWAEKSHCIIMEYLQSGSFDIYLRFTAPNL-NNPRLVSFALDIANGMKYLSDMGLIHRDLAAR 1018
             .|       |:||::..|:...:||.....| :..:|:.|||.:|.||:||....|:|||||||
Mouse   298 GLY-------IVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESKKLVHRDLAAR 355

  Fly  1019 NILVDHNGDGDCV-KISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGV 1082
            ||||..    |.| |:||||||: |...|   ..|.| :|::|.:|||:...||||.|||||:||
Mouse   356 NILVSE----DLVAKVSDFGLAK-AERKG---LDSSR-LPVKWTAPEALKNGRFSSKSDVWSFGV 411

  Fly  1083 TLFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATI 1147
            .|:|:||.|..|  .| :.|.::....::.|.|:..|..||..::.||..||.|.|..||.|..|
Mouse   412 LLWEVFSYGRAP--YP-KMSLKEVSEAVEKGYRMEPPDGCPGSVHTLMGSCWEAEPARRPPFRKI 473

  Fly  1148 VDIITREV-ATKVTHPTDGHQSPPNQPTDAE 1177
            |:.:.||: :..|:.|..|.::..:.||.::
Mouse   474 VEKLGRELRSVGVSAPAGGQEAEGSAPTRSQ 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633
PTKc_Jak_rpt2 886..1155 CDD:270634 99/266 (37%)
TyrKc 894..1151 CDD:197581 98/262 (37%)
MatkXP_006513357.1 SH3 49..107 CDD:388381
SH2_csk_like 117..214 CDD:198190
PKc_like 227..480 CDD:389743 98/265 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.