DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Itk

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_001268894.1 Gene:Itk / 16428 MGIID:96621 Length:625 Species:Mus musculus


Alignment Length:700 Identity:181/700 - (25%)
Similarity:280/700 - (40%) Gaps:171/700 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 LLLPKNLKAKKTDLQLSEAELQRRNPQIFNPR------TDLQWYPDSISLSDDGMMFTMRGDWIQ 603
            :||.:.| .||:.      :.:|.:|..|..|      ..|.::.|.     .|...|::|. |:
Mouse     5 ILLEEQL-IKKSQ------QKRRTSPSNFKVRFFVLTKASLAYFEDR-----HGKKRTLKGS-IE 56

  Fly   604 QSPVKDVSVTMKMLKSDGNFMEFFRLAQTWSLIQSPQFLKLYGLTLADPYTMVMEYSRYGPLNKF 668
            .|.:|.|.:    :|||               |..|...|....||.  |..|:.          
Mouse    57 LSRIKCVEI----VKSD---------------ISIPCHYKYPFQTLV--YLQVVH---------- 90

  Fly   669 LHSMPNVTLHCLLDLMHGLVRGMHYLEDNKIIHNYIRCSNLYVTKYDPNSYVLD------AKISD 727
                .|..|:..........|.:..|::.      .|.:|..|:||.|| :.:|      :::..
Mouse    91 ----DNYLLYVFAPDCESRQRWVLTLKEE------TRNNNSLVSKYHPN-FWMDGRWRCCSQLEK 144

  Fly   728 PGYP-RPYRESDS------PWIPVKYYRNLQAAKTDQFAQLWAFATT-IYEIFSRCKEDLSTLRQ 784
            |... .||..|.:      |..|....|:.|..:......|:.:.|. ..|:..||.|:...|..
Mouse   145 PAVGCAPYDPSKNASKKPLPPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDS 209

  Fly   785 EQL----LRQKN-------------LDGNIL-------KMLDQDICPAPIFETIMDG---WSDDE 822
            .::    ::.||             ...|.|       |.:.:|.....:.:|..:|   ..|..
Mouse   210 SEIHWWRVQDKNGHEGYAPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSR 274

  Fly   823 TKRFSHHDIFSRLNTIKAEILPNYMPPPEI------ATNGT------GDETVIDRSDIPF----- 870
            |.......:|:     ||.|..|    |.|      .||.:      .::.|.|  .||.     
Mouse   275 TPGTYTVSVFT-----KAIISEN----PCIKHYHIKETNDSPKRYYVAEKYVFD--SIPLLIQYH 328

  Fly   871 ----------LPFPRSNMLMVIPLTSECR----VIYNME----NMIGRGHYGTVYKGHLEFNDKD 917
                      |.:|..:.....|:|:..|    ||...|    ..||.|.:|.|:.|:....|| 
Mouse   329 QYNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDK- 392

  Fly   918 QPREQVAIKMLNTMQVS-TDFHREIGIMRTLSHPNIVK-FKYWAEKSH-CIIMEYLQSGSFDIYL 979
                 ||||.:....:| .||..|..:|..||||.:|: :....|::. |::.|:::.|....||
Mouse   393 -----VAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYL 452

  Fly   980 RFTAPNLNNPRLVSFALDIANGMKYLSDMGLIHRDLAARNILVDHNGDGDCVKISDFGLAQFANS 1044
            |..........|:...||:..||.||....:|||||||||.||   |:...:|:||||:.:|. .
Mouse   453 RSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLV---GENQVIKVSDFGMTRFV-L 513

  Fly  1045 DGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMFSRGEEPNLVPIQT-SQEDFLN 1108
            |..|.:.:....|::|.|||..|..|:||.|||||:||.::|:||.|:    :|.:. |..:.:.
Mouse   514 DDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGK----IPYENRSNSEVVE 574

  Fly  1109 RLQSGERLNRP--ASCPDFIYDLMQLCWHATPRSRPSFATIVDIITREVA 1156
            .:.:|.||.:|  |||  .:|.:|..||...|..||.|:.::..:. |:|
Mouse   575 DISTGFRLYKPRLASC--HVYQIMNHCWKEKPEDRPPFSQLLSQLA-EIA 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 56/292 (19%)
PTKc_Jak_rpt2 886..1155 CDD:270634 97/282 (34%)
TyrKc 894..1151 CDD:197581 94/266 (35%)
ItkNP_001268894.1 PH 5..117 CDD:278594 32/165 (19%)
PH_Btk 7..154 CDD:269944 42/201 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174 4/20 (20%)
SH3_ITK 180..235 CDD:212841 9/54 (17%)
SH2_Tec_Itk 238..345 CDD:198259 23/117 (20%)
PTKc_Itk 363..618 CDD:133243 95/270 (35%)
Pkinase_Tyr 368..617 CDD:285015 93/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.