DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hop and Hck

DIOPT Version :9

Sequence 1:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_034537.2 Gene:Hck / 15162 MGIID:96052 Length:524 Species:Mus musculus


Alignment Length:518 Identity:132/518 - (25%)
Similarity:218/518 - (42%) Gaps:92/518 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 SRYGPLNKFLHSMPNVTLHCLLDLMHGLVRGMHYLEDNKIIHNY----IRCSNLYVTKYDPNSYV 720
            |:.||.|.  :|||           .|.|.|.   ||..::..|    |...:|...|.|  ..|
Mouse    58 SKLGPNNS--NSMP-----------PGFVEGS---EDTIVVALYDYEAIHREDLSFQKGD--QMV 104

  Fly   721 LDAKISDPGYPRPYRESDSPWIPVKYYRNLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSTLRQE 785
            :..:..:....|........:||..|...:.:.:|::    |.|.       ...::|    .:.
Mouse   105 VLEEAGEWWKARSLATKKEGYIPSNYVARVNSLETEE----WFFK-------GISRKD----AER 154

  Fly   786 QLLRQKNLDGNILKMLDQDICPAPIFETI--MDGWSDDETKRF------------SHHDIFSRLN 836
            .||...|:.|:.: :.|.:........::  .|....|..|.:            |....||.|.
Mouse   155 HLLAPGNMLGSFM-IRDSETTKGSYSLSVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQ 218

  Fly   837 TIKAEILPNYMPPPEIATNGTGDETVIDRSDIPFL-PFPRSNMLMVIPLTSEC----RVIYNMEN 896
                |::.:|.         .|.:.:..:..:|.: |.|:.      |...:.    |....||.
Mouse   219 ----ELVLHYK---------KGKDGLCQKLSVPCVSPKPQK------PWEKDAWEIPRESLQMEK 264

  Fly   897 MIGRGHYGTVYKGHLEFNDKDQPREQVAIKMLNTMQVSTD-FHREIGIMRTLSHPNIVKF-KYWA 959
            .:|.|.:|.|:......:.|      ||:|.:....:|.: |..|..:|::|.|..:||. ...:
Mouse   265 KLGAGQFGEVWMATYNKHTK------VAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVS 323

  Fly   960 EKSHCIIMEYLQSGSFDIYLRFTAPNLNN-PRLVSFALDIANGMKYLSDMGLIHRDLAARNILVD 1023
            ::...|:.|::..||...:|:....:... |:|:.|:..|:.||.::.....|||||.|.|||| 
Mouse   324 QEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILV- 387

  Fly  1024 HNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFSSYSDVWSYGVTLFEMF 1088
             :....| ||:|||||:.. .|..|.|:.....||:|.:||||:...|:..|||||:|:.|.|:.
Mouse   388 -SASLVC-KIADFGLARII-EDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIV 449

  Fly  1089 SRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHATPRSRPSFATIVDII 1151
            :.|..|  .| ..|..:.:..|:.|.|:.||.:||:.:|::|..||...|..||:|..|..::
Mouse   450 TYGRIP--YP-GMSNPEVIRALEHGYRMPRPDNCPEELYNIMIRCWKNRPEERPTFEYIQSVL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 37/193 (19%)
PTKc_Jak_rpt2 886..1155 CDD:270634 87/273 (32%)
TyrKc 894..1151 CDD:197581 86/259 (33%)
HckNP_034537.2 SH3 80..135 CDD:302595 10/56 (18%)
SH2_Src_HCK 138..241 CDD:198226 20/131 (15%)
PKc_like 252..522 CDD:304357 87/271 (32%)
Pkinase_Tyr 260..509 CDD:285015 86/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.