DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pa1 and PAGR1

DIOPT Version :10

Sequence 1:NP_572712.1 Gene:Pa1 / 32079 FlyBaseID:FBgn0287454 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_078792.1 Gene:PAGR1 / 79447 HGNCID:28707 Length:254 Species:Homo sapiens


Alignment Length:100 Identity:30/100 - (30%)
Similarity:50/100 - (50%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ELEGYYLMLEAGNIPELQWQFPGRRAPSPEAGS-GGNSKELEQATDAIEQEPQKANDFDFSDDVA 84
            |::..|.:|.|....|||.:...||.|:|||.| ...|.|..:|.:..|::|....:|||.|:..
Human   111 EIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPV 175

  Fly    85 PTQMRVRSQTSTPKS---AKKKTANFAGVMETLKK 116
            ..:..:..:..||.|   ::|:.|....|:..:|:
Human   176 TPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pa1NP_572712.1 PAXIP1_C 18..116 CDD:464674 29/98 (30%)
PAGR1NP_078792.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111 30/99 (30%)
PAXIP1_C 86..218 CDD:464674 30/99 (30%)
Sufficient for interaction with NCOA1. /evidence=ECO:0000269|PubMed:19039327 116..160 16/43 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..254 25/83 (30%)
Sufficient for interaction with ESR1. /evidence=ECO:0000269|PubMed:19039327 161..254 12/49 (24%)

Return to query results.
Submit another query.